EGR1


EGR-1 also known as ZNF268 or NGFI-A is a protein that in humans is encoded by the EGR1 gene.
EGR-1 is a mammalian transcription factor. It was also named Krox-24, TIS8, and ZENK. It was originally discovered in mice.

Function

The protein encoded by this gene belongs to the EGR family of Cys2His2-type zinc finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentiation and mitogenesis. Studies suggest this is a tumor suppressor gene.
It has a distinct pattern of expression in the brain, and its induction has been shown to be associated with neuronal activity. Several studies suggest it has a role in neuronal plasticity.
EGR-1 is an important transcription factor in memory formation. It has an essential role in brain neuron epigenetic reprogramming. EGR-1 recruits the TET1 protein that initiates a pathway of DNA demethylation. Removing DNA methylation marks allows the activation of downstream genes. EGR-1, together with TET1, is employed in programming the distribution of methylation sites on brain DNA during brain development, in learning and in long-term neuronal plasticity.
EGR-1 has also been found to regulate the expression of VAMP2.

Structure

The DNA-binding domain of EGR-1 consists of three zinc finger domains of the Cys2His2 type.
The amino acid structure of the EGR-1 zinc finger domain is given in this table, using the single letter amino acid code. The fingers 1 to 3 are indicated by f1 - f3. The numbers are in reference to the residues of alpha helix. The residues marked 'x' are not part of the zinc fingers, but rather serve to connect them all together.
-1123456789xxxxx-
f1MAEERPYACPVESCDRRFSRSDELTRHIRIHTGQKP-
f2FQCAI--CMRNFSRSDHLTTHIATHTGEKP-
f3FACDI--CGRKFARSDERKRHTKIHLRQKD

Amino acid key: Alanine, Arginine, Asparagine, Aspartic acid, Cysteine, Glutamic acid, Glutamine, Glycine, Histidine, Isoleucine, Leucine, Lysine, Methionine, Phenylalanine, Proline, Serine, Threonine, Tryptophan, Tyrosine, Valine
The crystal structure of DNA bound by the zinc finger domain of EGR-1 was solved in 1991, which greatly aided early research in zinc finger DNA-binding domains.
The human EGR-1 protein contains 543 amino acids with a molecular weight of 57.5 kDa, and the gene is located on the chromosome 5.

DNA binding specificity

EGR-1 binds the DNA sequence 5'-GCG TGG GCG-3'.
The f1 position 6 binds the 5' G ; the f1 position 3 to the second base ; f1 position -1 binds to the third position ; f2 position 6 to the fourth base ; and so on.

Interactions

EGR-1 has been shown to interact with: